Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000346-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000346-M01, RRID:AB_425311
- Product name
- APOC4 monoclonal antibody (M01), clone 3D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant APOC4.
- Antigen sequence
CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETV
VNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPL
TKAWFLESKDSLLKKTHSLCPRLVCGDKDQG- Isotype
- IgG
- Antibody clone number
- 3D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparative proteomic profiling of plasma very-low-density and low-density lipoproteins.
Sun HY, Chen SF, Lai MD, Chang TT, Chen TL, Li PY, Shieh DB, Young KC
Clinica chimica acta; international journal of clinical chemistry 2010 Mar;411(5-6):336-44
Clinica chimica acta; international journal of clinical chemistry 2010 Mar;411(5-6):336-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of APOC4 expression in transfected 293T cell line by APOC4 monoclonal antibody (M01), clone 3D10.Lane 1: APOC4 transfected lysate(14.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of APOC4 transfected lysate using anti-APOC4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with APOC4 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol