HPA000440

PTPRC antibody from Sigma-Aldrich
CD45, GP180, LCA, T200
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000440
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000440, RRID:AB_1078468
Product name
Anti-PTPRC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000440
Antibody type
Polyclonal
Antigen
Leukocyte common antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDF
GSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTL
CYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSL
HAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
Storage
-20C
Provider Type Product Number
- No reagents -