HPA023589

NAA15 antibody from MilliporeSigma / Merck KGaA
FLJ13340, NARG1, NATH, TBDN100
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023589
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023589, RRID:AB_1854311
Product name
Anti-NARG1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023589
Antibody type
Polyclonal
Antigen
NMDA receptor-regulated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDA
ADVYRGLQERNPENWAYYKGLEKALKPANMLERLK
IYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKF
LRMNFSKG
Storage
-20C
Provider Type Product Number
- No reagents -