HPA019818

ARHGAP23 antibody from MilliporeSigma / Merck KGaA
KIAA1501
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019818
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019818, RRID:AB_1844993
Product name
Anti-ARHGAP23 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019818
Antibody type
Polyclonal
Antigen
Rho GTPase-activating protein 23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSL
ASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAP
VLGTSPSS
Storage
-20C
Provider Type Product Number
- No reagents -