HPA017369

CHGA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017369
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017369, RRID:AB_1846698
Product name
Anti-CHGA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017369
Antibody type
Polyclonal
Antigen
Chromogranin-A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQEC
FETLRGDERILSILRHQNLLKELQDLALQGAKERA
HQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSS
KDVMEKREDSKEAEKSGEATDGARPQALPEPMQES
K
Storage
-20C
Provider Type Product Number
- No reagents -