HPA010786

FER1L5 antibody from Sigma-Aldrich
DKFZp434I0121
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010786
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010786, RRID:AB_1848496
Product name
Anti-FER1L5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010786
Antibody type
Polyclonal
Antigen
Fer-1-like protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPQLQLYPPIKIFNIINSLNTSNASSSILPTQDPN
LKPTIDHEWKLHPGPTNHLSDIFPELPAPGD
Storage
-20C
Provider Type Product Number
- No reagents -