HPA015015

SCYL1 antibody from Sigma-Aldrich
GKLP, HT019, MGC78454, NKTL, NTKL, P105, TAPK, TEIF, TRAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015015
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015015, RRID:AB_1856643
Product name
Anti-SCYL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015015
Antibody type
Polyclonal
Antigen
N-terminal kinase-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKV
GKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQ
MEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQ
TVKSMLLLAPKLNEANLNVELMK
Storage
-20C
Provider Type Product Number
- No reagents -