HPA015015

SCYL1 antibody from Atlas Antibodies
GKLP, HT019, MGC78454, NKTL, NTKL, P105, TAPK, TEIF, TRAP

Antibody data

Product number
HPA015015
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015015, RRID:AB_1856643
Product name
Anti-SCYL1
Provider product page
Atlas Antibodies - HPA015015
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKV
GKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQ
MEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQ
TVKSMLLLAPKLNEANLNVELMK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.