HPA000450

ESR1 antibody from Atlas Antibodies
ER-alpha, Era, ESR, NR3A1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000450
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000450, RRID:AB_1078754
Product name
Anti-ESR1
Provider product page
Atlas Antibodies - HPA000450
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDH
IHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLL
ILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEML
DAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSL
QKYYIT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -