HPA024794

RDM1 antibody from Atlas Antibodies
MGC33977, RAD52B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024794
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024794, RRID:AB_1856039
Product name
Anti-RDM1
Provider product page
Atlas Antibodies - HPA024794
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPVKVRLGTRHKAVQHQALALNSSKCQELANYYFG
FNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLK
FFCALEVVLPSCDCRSPGIGLVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -