HPA024708

RDM1 antibody from Sigma-Aldrich
MGC33977, RAD52B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024708
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024708, RRID:AB_1856038
Product name
Anti-RDM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024708
Antibody type
Polyclonal
Antigen
RAD52 motif-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLI
VVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPC
SPWKQYGQEEEGYLSDFS
Storage
-20C
Provider Type Product Number
- No reagents -