HPA024288

RHPN1 antibody from Sigma-Aldrich
KIAA1929, ODF5, RHPN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024288
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024288, RRID:AB_1856274
Product name
Anti-RHPN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024288
Antibody type
Polyclonal
Antigen
rhophilin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVVTELKAAGEAGASLQVVSLLPSSRLPSLGDRRP
VLLGPRGLLRSQREHGCKTPASTWASPRPLLNWSR
KAQQGKTGGCPQPCAPVKPAP
Storage
-20C
Provider Type Product Number
- No reagents -