HPA014668

PCDHB16 antibody from Sigma-Aldrich
KIAA1621, ME1, PCDH-BETA16, PCDH3X, PCDHB8a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014668
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014668, RRID:AB_1855055
Product name
Anti-PCDHB16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014668
Antibody type
Polyclonal
Antigen
Protocadherin beta-16 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEETERGSFVANLGKDLGLGLTEMSTRKARIISQG
NKQHLQLKAQTGDLLINEKLDREELCGPTEPCILH
FQVLMENPLEIFQAELRVIDIND
Storage
-20C
Provider Type Product Number
- No reagents -