HPA000850

NOP9 antibody from Sigma-Aldrich
C14orf21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000850
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000850, RRID:AB_1078287
Product name
Anti-C14orf21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000850
Antibody type
Polyclonal
Antigen
Pumilio domain-containing protein C14orf21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLEAFHCAEPSSRQVACVPLFATLMAYEVYYGLT
EEEGAVPAEHQVAMAAARALGDVTVLGSLLLQHLL
HFSTPGLVLRSLGALTGPQLLSLAQSPAGSHVLDA
ILTSPSVTRKLRRRVLQNLKGQYVALACSRHGSRV
LDAIWS
Storage
-20C
Provider Type Product Number
- No reagents -