HPA000873

DGCR2 antibody from Atlas Antibodies
DGS-C, IDD, KIAA0163, LAN, SEZ-12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000873, RRID:AB_1668705
Product name
Anti-DGCR2
Provider product page
Atlas Antibodies - HPA000873
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQT
CQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWK
DQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVF
LPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDL
HSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFY
FTPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -