HPA000873

DGCR2 antibody from Atlas Antibodies
DGS-C, IDD, KIAA0163, LAN, SEZ-12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000873, RRID:AB_1847632
Product name
Anti-DGCR2
Provider product page
Atlas Antibodies - HPA000873
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQT
CQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWK
DQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVF
LPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDL
HSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFY
FTPK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -