HPA000873

DGCR2 antibody from Sigma-Aldrich
DGS-C, IDD, KIAA0163, LAN, SEZ-12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000873, RRID:AB_1847632
Product name
Anti-DGCR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000873
Antibody type
Polyclonal
Antigen
Integral membrane protein DGCR2/IDD Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQT
CQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWK
DQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVF
LPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDL
HSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFY
FTPK
Storage
-20C
Provider Type Product Number
- No reagents -