HPA003920

UBE2D2 antibody from Atlas Antibodies
UBC4, UbcH5B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003920
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003920, RRID:AB_1236048
Product name
Anti-UBE2D2
Provider product page
Atlas Antibodies - HPA003920
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSP
YQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNIN
SNGSICLDILRS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -