HPA003920

UBE2D2 antibody from Atlas Antibodies
UBC4, UbcH5B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003920
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003920, RRID:AB_1858519
Product name
Anti-UBE2D2
Provider product page
Atlas Antibodies - HPA003920
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSP
YQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNIN
SNGSICLDILRS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -