HPA023535

SON antibody from Atlas Antibodies
BASS1, C21orf50, DBP-5, FLJ21099, FLJ33914, KIAA1019, NREBP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023535
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023535, RRID:AB_1857362
Product name
Anti-SON
Provider product page
Atlas Antibodies - HPA023535
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TEVAIESTPMILESSIMSSHVMKGINLSSGDQNLA
PEIGMQEIALHSGEEPHAEEHLKGDFYESEHGINI
DLNINNHLIAKEMEHNTVCAAGTSPVGEIGEEKIL
PTSETKQRTVLDTYPGVSEADAGETLSSTGP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -