HPA023535
antibody from Atlas Antibodies
Targeting: SON
BASS1, C21orf50, DBP-5, FLJ21099, FLJ33914, KIAA1019, NREBP
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023535 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023535, RRID:AB_1857362
- Product name
- Anti-SON
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TEVAIESTPMILESSIMSSHVMKGINLSSGDQNLA
PEIGMQEIALHSGEEPHAEEHLKGDFYESEHGINI
DLNINNHLIAKEMEHNTVCAAGTSPVGEIGEEKIL
PTSETKQRTVLDTYPGVSEADAGETLSSTGP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
Antibody-based protein profiling of the human chromosome 21.
Clustering phenotype populations by genome-wide RNAi and multiparametric imaging.
Ammon T, Mishra SK, Kowalska K, Popowicz GM, Holak TA, Jentsch S
Journal of molecular cell biology 2014 Aug;6(4):312-23
Journal of molecular cell biology 2014 Aug;6(4):312-23
Antibody-based protein profiling of the human chromosome 21.
Uhlén M, Oksvold P, Älgenäs C, Hamsten C, Fagerberg L, Klevebring D, Lundberg E, Odeberg J, Pontén F, Kondo T, Sivertsson Å
Molecular & cellular proteomics : MCP 2012 Mar;11(3):M111.013458
Molecular & cellular proteomics : MCP 2012 Mar;11(3):M111.013458
Clustering phenotype populations by genome-wide RNAi and multiparametric imaging.
Fuchs F, Pau G, Kranz D, Sklyar O, Budjan C, Steinbrink S, Horn T, Pedal A, Huber W, Boutros M
Molecular systems biology 2010 Jun 8;6:370
Molecular systems biology 2010 Jun 8;6:370
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-SON antibody HPA023535 (A) shows similar pattern to independent antibody HPA031755 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate to strong positivity in nuclear speckles in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate to strong positivity in nuclear speckles in Purkinje cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate to strong positivity in nuclear speckles in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate to strong positivity in nuclear speckles in germinal center cells.
- Sample type
- HUMAN