PAB21585
antibody from Abnova Corporation
Targeting: SON
BASS1, C21orf50, DBP-5, FLJ21099, FLJ33914, KIAA1019, NREBP
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21585 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21585, RRID:AB_10961735
- Product name
- SON polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SON.
- Antigen sequence
TEVAIESTPMILESSIMSSHVMKGINLSSGDQNLA
PEIGMQEIALHSGEEPHAEEHLKGDFYESEHGINI
DLNINNHLIAKEMEHNTVCAAGTSPVGEIGEEKIL
PTSETKQRTVLDTYPGVSEADAGETLSSTGP- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Involvement of SRSF11 in cell cycle-specific recruitment of telomerase to telomeres at nuclear speckles.
Lee JH, Jeong SA, Khadka P, Hong J, Chung IK
Nucleic acids research 2015 Sep 30;43(17):8435-51
Nucleic acids research 2015 Sep 30;43(17):8435-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SON polyclonal antibody (Cat # PAB21585) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251MG with SON polyclonal antibody (Cat # PAB21585) at 1-4 ug/mL dilution shows positivity in nuclei but not nucleoli.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human small intestine with SON polyclonal antibody (Cat # PAB21585) shows strong nuclear positivity in glandular cells at 1:1000-1:2500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)