HPA023535

SON antibody from Sigma-Aldrich
BASS1, C21orf50, DBP-5, FLJ21099, FLJ33914, KIAA1019, NREBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023535
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023535, RRID:AB_1857362
Product name
Anti-SON antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023535
Antibody type
Polyclonal
Antigen
SON protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEVAIESTPMILESSIMSSHVMKGINLSSGDQNLA
PEIGMQEIALHSGEEPHAEEHLKGDFYESEHGINI
DLNINNHLIAKEMEHNTVCAAGTSPVGEIGEEKIL
PTSETKQRTVLDTYPGVSEADAGETLSSTGP
Storage
-20C
Provider Type Product Number
- No reagents -