HPA009701

SRCIN1 antibody from Sigma-Aldrich
KIAA1684, p140Cap, SNIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009701
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009701, RRID:AB_1857324
Product name
Anti-AC115090.8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009701
Antibody type
Polyclonal
Antigen
p130Cas-associated protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQ
LGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKE
EPQRLDGLLKRCRGVTDTLAQIRR
Storage
-20C
Provider Type Product Number
- No reagents -