Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001472 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001472, RRID:AB_1078583
- Product name
- Anti-CTCFL
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVEL
VLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSI
QQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAIS
IQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Expression of cancer/testis antigens is correlated with improved survival in glioblastoma.
Widespread expression of BORIS/CTCFL in normal and cancer cells.
BORIS (CTCFL) is not expressed in most human breast cell lines and high grade breast carcinomas.
Freitas M, Malheiros S, Stávale JN, Biassi TP, Zamunér FT, de Souza Begnami M, Soares FA, Vettore AL
Oncotarget 2013 Apr;4(4):636-46
Oncotarget 2013 Apr;4(4):636-46
Widespread expression of BORIS/CTCFL in normal and cancer cells.
Jones TA, Ogunkolade BW, Szary J, Aarum J, Mumin MA, Patel S, Pieri CA, Sheer D
PloS one 2011;6(7):e22399
PloS one 2011;6(7):e22399
BORIS (CTCFL) is not expressed in most human breast cell lines and high grade breast carcinomas.
Hines WC, Bazarov AV, Mukhopadhyay R, Yaswen P
PloS one 2010 Mar 17;5(3):e9738
PloS one 2010 Mar 17;5(3):e9738
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA001472 antibody. Corresponding CTCFL RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN