HPA001472

CTCFL antibody from Atlas Antibodies
BORIS, CT27, dJ579F20.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001472
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001472, RRID:AB_1078583
Product name
Anti-CTCFL
Provider product page
Atlas Antibodies - HPA001472
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVEL
VLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSI
QQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAIS
IQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -