HPA001472

CTCFL antibody from Sigma-Aldrich
BORIS, CT27, dJ579F20.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001472
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001472, RRID:AB_1078583
Product name
Anti-CTCFL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001472
Antibody type
Polyclonal
Antigen
Transcriptional repressor CTCFL recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVEL
VLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSI
QQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAIS
IQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Storage
-20C
Provider Type Product Number
- No reagents -