HPA000937

TYRP1 antibody from Atlas Antibodies
b-PROTEIN, CAS2, CATB, GP75, OCA3, TRP, TYRP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000937
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000937, RRID:AB_1080437
Product name
Anti-TYRP1
Provider product page
Atlas Antibodies - HPA000937
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCD
SLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQR
LPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEG
YSDPTGKYDPAVRSLH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -