HPA000937

TYRP1 antibody from Sigma-Aldrich
b-PROTEIN, CAS2, CATB, GP75, OCA3, TRP, TYRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000937
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000937, RRID:AB_1080437
Product name
Anti-TYRP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000937
Antibody type
Polyclonal
Antigen
5,6-Dihydroxyindole-2-carboxylic acid oxidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCD
SLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQR
LPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEG
YSDPTGKYDPAVRSLH
Storage
-20C
Provider Type Product Number
- No reagents -