HPA019130

RNF115 antibody from Sigma-Aldrich
CL469780, ZNF364
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019130
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019130, RRID:AB_1859220
Product name
Anti-RNF115 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019130
Antibody type
Polyclonal
Antigen
RING finger protein 115 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPE
YICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTH
FAELWGHLDHTMFFQDFRPFLSSSPLDQDNRAN
Storage
-20C
Provider Type Product Number
- No reagents -