HPA019130

RNF115 antibody from Atlas Antibodies
CL469780, ZNF364
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019130
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019130, RRID:AB_1859220
Product name
Anti-RNF115
Provider product page
Atlas Antibodies - HPA019130
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPE
YICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTH
FAELWGHLDHTMFFQDFRPFLSSSPLDQDNRAN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -