HPA001337

PMEL antibody from Sigma-Aldrich
D12S53E, gp100, Pmel17, SI, SIL, SILV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001337
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001337, RRID:AB_1079970
Product name
Anti-SILV antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001337
Antibody type
Polyclonal
Antigen
Melanocyte protein Pmel 17 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFSVSVSQLRALDRGNKHFLRNQPLTFALQLHDPS
GYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEP
GPVTAQVVLQAAIPLTSCGSSPVPGTTDGHRPTAE
APNTTAGQVPTTEVVGTTPGQAPTAEPSGTTSCVR
RAPPLSNN-
Storage
-20C
Provider Type Product Number
- No reagents -