HPA019754

IK antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019754
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019754, RRID:AB_1851548
Product name
Anti-AC116353.2-2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019754
Antibody type
Polyclonal
Antigen
Protein Red recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RELAEKYRDRAKERRDGVNKDYEETELISTTANYR
AVGPTAEADKSAAEKRRQLIQESKFLGGDMEHTHL
VKGLDFALLQKVRAEIASKEKEEE
Storage
-20C
Provider Type Product Number
- No reagents -