HPA017373

ITIH3 antibody from Sigma-Aldrich
H3P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017373
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017373, RRID:AB_1851954
Product name
Anti-ITIH3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017373
Antibody type
Polyclonal
Antigen
Inter-alpha-trypsin inhibitor heavy chain H3 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAY
LTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFV
TPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSP
AMSYLTSYQPPQ
Storage
-20C
Provider Type Product Number
- No reagents -