Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183676 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Goosecoid Homeobox 2 (GSC2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GSCL antibody: synthetic peptide directed towards the C terminal of human GSCL
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
LEALFVQNQYPDVSTRERLAGRIRLREERVEVWFK
NRRAK WRHQKRASAS- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Rnf4, a RING protein expressed in the developing nervous and reproductive systems, interacts with Gscl, a gene within the DiGeorge critical region.
Galili N, Nayak S, Epstein JA, Buck CA
Developmental dynamics : an official publication of the American Association of Anatomists 2000 May;218(1):102-11
Developmental dynamics : an official publication of the American Association of Anatomists 2000 May;218(1):102-11
No comments: Submit comment
No validations: Submit validation data