H00009939-B01

RBM8A antibody from Abnova Corporation
BOV-1A, BOV-1B, BOV-1C, RBM8, RBM8B, Y14, ZNRP

Antibody data

Product number
H00009939-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009939-B01, RRID:AB_1204903
Product name
RBM8A MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00009939-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RBM8A protein.
Antigen sequence
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKR
KGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLN
LDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM
GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -