HPA023554

SYNRG antibody from Atlas Antibodies
AP1GBP1, MGC104959, SYNG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023554
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023554, RRID:AB_1844892
Product name
Anti-SYNRG
Provider product page
Atlas Antibodies - HPA023554
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FMAFSNSSISSEQKPDDKYDALKEEASPVPLTSNV
GSTVKGGQNSTAASTKYDVFRQLSLEGSGLGVEDL
KDNTPSGKSDDDFADFHS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -