HPA023555

SYNRG antibody from Sigma-Aldrich
AP1GBP1, MGC104959, SYNG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023555
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023555, RRID:AB_2058337
Product name
Anti-AP1GBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023555
Antibody type
Polyclonal
Antigen
AP1 subunit gamma-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQQGFPMVSVMQPNMQGIMGMNYSSQMSQGPIAMQ
AGIPMGPMPAAGMPYLGQAPFLGMRPPGPQYTPDM
QKQFAEEQQKRFEQQQKLLEEERKRRQFEEQKQKL
RLLSSVKP
Storage
-20C
Provider Type Product Number
- No reagents -