HPA019120

CRYZL1 antibody from Sigma-Aldrich
4P11, QOH-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019120
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019120, RRID:AB_1847264
Product name
Anti-CRYZL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019120
Antibody type
Polyclonal
Antigen
Quinone oxidoreductase-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKL
QVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV
LD
Storage
-20C
Provider Type Product Number
- No reagents -