HPA019120

CRYZL1 antibody from Atlas Antibodies
4P11, QOH-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019120
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019120, RRID:AB_1847264
Product name
Anti-CRYZL1
Provider product page
Atlas Antibodies - HPA019120
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKL
QVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV
LD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -