HPA000942

MAP3K9 antibody from Sigma-Aldrich
MEKK9, MLK1, PRKE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000942
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000942, RRID:AB_1079360
Product name
Anti-MAP3K9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000942
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQ
WSSSAPNLVKGPRSSPALPGFTSLMEMEDEDSEGP
GSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIH
EEPTPVNSATSTPQLTPTNSLKRGG
Storage
-20C
Provider Type Product Number
- No reagents -