HPA004742

CTNNBL1 antibody from MilliporeSigma / Merck KGaA
C20orf33, FLJ21108, NAP, NYD-SP19, P14, P14L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004742
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA004742, RRID:AB_1847323
Product name
Anti-CTNNBL1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA004742
Antibody type
Polyclonal
Antigen
Beta-catenin-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNP
EKFMESELDLNDIIQEMHVVATMPDLYHLLVELNA
VQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHES
EEGAEVLIDALVDGQVVALLVQNLERLDESV
Storage
-20C
Provider Type Product Number
- No reagents -