HPA027907

CTNNBL1 antibody from Sigma-Aldrich
C20orf33, FLJ21108, NAP, NYD-SP19, P14, P14L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027907
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027907, RRID:AB_10601362
Product name
Anti-CTNNBL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027907
Antibody type
Polyclonal
Antigen
catenin, beta like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKR
LKAKMPFDANKLYCSEVLAILLQDNDENRELLGEL
DGIDVLLQQLSVFKRHNPSTA
Storage
-20C
Provider Type Product Number
- No reagents -