HPA019346

SNX30 antibody from Sigma-Aldrich
ATG24A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019346
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019346, RRID:AB_2286395
Product name
Anti-SNX30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019346
Antibody type
Polyclonal
Antigen
Sorting nexin-30 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSS
PASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHV
CTMETY
Storage
-20C
Provider Type Product Number
- No reagents -