HPA026995

POMP antibody from Atlas Antibodies
C13orf12, HSPC014, UMP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026995
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026995, RRID:AB_1845546
Product name
Anti-POMP
Provider product page
Atlas Antibodies - HPA026995
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SELKDSIPVTELSASGPFESHDLLRKGFSCVKNEL
LPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPL
KLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETI
GFE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -