HPA026995

POMP antibody from Sigma-Aldrich
C13orf12, HSPC014, UMP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026995
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026995, RRID:AB_1845546
Product name
Anti-POMP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026995
Antibody type
Polyclonal
Antigen
Proteasome maturation protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SELKDSIPVTELSASGPFESHDLLRKGFSCVKNEL
LPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPL
KLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETI
GFE
Storage
-20C
Provider Type Product Number
- No reagents -