HPA027551

TOX4 antibody from Atlas Antibodies
C14orf92, KIAA0737, LCP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027551
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027551, RRID:AB_10601701
Product name
Anti-TOX4
Provider product page
Atlas Antibodies - HPA027551
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PMATVDPASPAPASIEPPALSPSIVVNSTLSSYVA
NQASSGAGGQPNITKLIITKQMLPSSITMSQGGMV
TVIPATVVTSRGLQLGQTSTATIQPSQQAQIVTRS
VLQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQ
QQVTI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -