PAB21150

TOX4 antibody from Abnova Corporation
C14orf92, KIAA0737, LCP1

Antibody data

Product number
PAB21150
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21150, RRID:AB_10963232
Product name
TOX4 polyclonal antibody
Provider product page
Abnova Corporation - PAB21150
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TOX4.
Antigen sequence
MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTT
LVPPTVESSPERPMNNSPEAHTVEAPSPETICEMI
TDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSG
CENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -