HPA017880

TOX4 antibody from MilliporeSigma / Merck KGaA
C14orf92, KIAA0737, LCP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017880
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017880, RRID:AB_1845573
Product name
Anti-TOX4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017880
Antibody type
Polyclonal
Antigen
TOX high mobility group box family member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTT
LVPPTVESSPERPMNNSPEAHTVEAPSPETICEMI
TDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSG
CENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS
Storage
-20C
Provider Type Product Number
- No reagents -