HPA001204

STX17 antibody from Sigma-Aldrich
FLJ20651
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001204
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001204, RRID:AB_1080118
Product name
Anti-STX17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001204
Antibody type
Polyclonal
Antigen
Syntaxin-17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCR
IWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRK
DDLVLLKRMIDPVKEEASAATAEFLQLHLESVEEL
KKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQ
SLTQ
Storage
-20C
Provider Type Product Number
- No reagents -