HPA039930

SLC46A3 antibody from Atlas Antibodies
DKFZp686A1775, FLJ42613
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA039930
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039930, RRID:AB_10673263
Product name
Anti-SLC46A3
Provider product page
Atlas Antibodies - HPA039930
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEE
VQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -