PAB23463

SLC46A3 antibody from Abnova Corporation
DKFZp686A1775, FLJ42613

Antibody data

Product number
PAB23463
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23463, RRID:AB_11118702
Product name
SLC46A3 polyclonal antibody
Provider product page
Abnova Corporation - PAB23463
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SLC46A3.
Antigen sequence
RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEE
VQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -