AV44158

SLC46A3 antibody from Sigma-Aldrich
DKFZp686A1775, FLJ42613
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV44158
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV44158, RRID:AB_1857183
Product name
Anti-SLC46A3 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV44158
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SLC46A3 with an internal ID of P11934
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
KILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEET
GNYTFSSDSNISECE
Storage
-20C
Provider Type Product Number
- No reagents -