HPA001318

ERP44 antibody from Sigma-Aldrich
KIAA0573, PDIA10, TXNDC4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001318, RRID:AB_1080427
Product name
Anti-TXNDC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001318
Antibody type
Polyclonal
Antigen
Thioredoxin domain-containing protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMK
REYRGQRSVKALADYIRQQKSDPIQEIRDLAEITT
LDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCA
FLSAFGDVSKPERYSGDNIIYKPPGHSAPD
Storage
-20C
Provider Type Product Number
- No reagents -